PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA683G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 291aa    MW: 31811.7 Da    PI: 8.8512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA683G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-181357146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W++eEde l+  v+ +G+++W+ I++ ++ gR++k+c++rw +
      AA683G00001 13 KGPWSQEEDEALKMWVQTYGPRNWSHISKSIP-GRSGKSCRLRWCN 57
                     79******************************.***********87 PP

2Myb_DNA-binding53.26.7e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++TteEd  +++a++qlG++ W+tIar+++ gR ++ +k+rw++ 
      AA683G00001  67 PFTTEEDNAIIRAHAQLGNK-WATIARMIN-GRIDNAIKNRWNST 109
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.323859IPR017930Myb domain
SuperFamilySSF466895.03E-3011106IPR009057Homeodomain-like
SMARTSM007177.1E-161261IPR001005SANT/Myb domain
PfamPF002494.8E-171357IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-241466IPR009057Homeodomain-like
CDDcd001671.98E-151557No hitNo description
PROSITE profilePS5129423.48760114IPR017930Myb domain
SMARTSM007171.7E-1364112IPR001005SANT/Myb domain
PfamPF002494.5E-1467109IPR001005SANT/Myb domain
CDDcd001675.23E-1167110No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2267113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTSSARRVSD QIKGPWSQEE DEALKMWVQT YGPRNWSHIS KSIPGRSGKS CRLRWCNQIS  60
PDVEHRPFTT EEDNAIIRAH AQLGNKWATI ARMINGRIDN AIKNRWNSTL KRKCTSMAVG  120
SDGPTVLSEF EQPLKRSASL GATNLLTGLS FHPSSSSGSE LSDYSLPGAS TSSVHRPVAR  180
IDSIVPASKH VGSVSDPTTL LSLSLPGLEP SDQAASGSES NQVSDPTSNV KVSKVMSLRQ  240
PDPPLLLPHA SSPFSSDNQF FNMEFLTVVQ EMIRKEVGNH VTGIYQKEVS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-35121143105C-Myb DNA-Binding Domain
1mse_C1e-35121143105C-Myb DNA-Binding Domain
1gv2_A1e-35121143105MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-351211357158MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-351211357158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556427.11e-105PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-74MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067KZQ61e-104A0A067KZQ6_JATCU; MYB family protein
STRINGPOPTR_0002s12410.13e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-64myb domain protein r1